PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G05500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 239aa    MW: 25098.2 Da    PI: 9.3938
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G05500.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.79.2e-071401822163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L  eN++L++e+  l+  + +l +e+
  LPERR02G05500.1 140 RSRKKMRLPEVQQLVRSLAVENESLREEMRALQRACTALSKEN 182
                      99*************************************9987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MMAACAGEGD DEVAAGIICS LRGADLAGWT PPWWCGKQQV EEELIWPAVK RGKRSRRGSP  60
AVAGKGRWGR GSPASPLDYS GGSRSGSGSA SASTSGGEDG GAFCSPAATA TTTMPKVGGM  120
GRQHMTFPAA PSPLRPAGQR SRKKMRLPEV QQLVRSLAVE NESLREEMRA LQRACTALSK  180
ENDKLEIRFE ISSSKNNASA KDLKGKQLDQ QSDMQSAGGG FALPDLNLPV KDGADGSVH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145RSRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626239.19e-98PREDICTED: uncharacterized protein LOC4328519 isoform X1
TrEMBLA0A0D9VD101e-174A0A0D9VD10_9ORYZ; Uncharacterized protein
STRINGORGLA02G0057900.11e-98(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951